A practical reference on circadian clock: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2026-01-01 and is reviewed periodically as new material appears.
Physicochemical behavior influences handling. SR9009 is described as a solid with limited aqueous solubility, so organic solvents such as dimethyl sulfoxide or ethanol are common in research stock solutions. Aqueous dilution can produce precipitates if the organic content is too low. Light, heat, and repeated freeze-thaw cycles may affect stability. Storage recommendations usually specify a desiccated freezer environment protected from light, but exact stability data depend on the formulation and matrix.
Detection in biological samples can be complicated by rapid metabolism and low circulating concentrations. Some studies report phase I and phase II metabolites, and analytical methods may need to target those species in addition to the parent compound. Immunoassays are not broadly available, so mass spectrometry remains the main confirmatory approach. For anti-doping testing, laboratories look for SR9009 and its metabolites using validated LC-MS methods. Open questions include how long metabolites remain detectable and how different routes of administration alter detection windows.
In laboratory settings, SR9009 is typically characterized by liquid chromatography–mass spectrometry (LC-MS) or high-performance liquid chromatography with ultraviolet detection (HPLC-UV). These methods can confirm identity and estimate purity, but they require reference standards for accurate quantification. Because SR9009 is not a licensed pharmaceutical, no harmonized pharmacopeial monograph exists. Laboratories often validate in-house methods for matrices such as plasma, urine, or cell culture media. Sample preparation may involve protein precipitation or liquid-liquid extraction before analysis.
Preclinical reports describe effects on exercise endurance, mitochondrial content, and lipid profiles in rodents, but these findings come from specific experimental conditions. Many studies use high doses or delivery methods that may not translate directly to human use. SR9009 has been reported to have low oral bioavailability and a short half-life, which complicates interpretation of oral dosing studies. It is not established as safe or effective for any indication. Literature discussions often separate its pharmacological mechanism from unverified claims made in fitness and supplement markets.
SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ. It is not an approved medicine and has no established human therapeutic use. The compound appears in scientific literature as a tool for probing circadian and metabolic regulation. Online sellers often label it as a research chemical, sometimes using the nickname Stenabolic. Its chemical identity is distinct from selective androgen receptor modulators, stimulants, and peroxisome proliferator-activated receptor delta agonists. Researchers use it mainly in cell and animal experiments.
At the molecular level, SR9009 binds REV-ERBα and REV-ERBβ and alters their repressive activity on target genes. These nuclear receptors help regulate the circadian clock, lipid synthesis, glucose metabolism, and inflammatory pathways. By changing transcription, the compound can shift the timing or magnitude of downstream metabolic processes in model systems. It does not act through androgen receptors or adenosine receptors, which distinguishes it from several substances sold for athletic performance. Whether the same transcriptional changes occur in humans at tolerable exposures remains an open question because controlled human studies are lacking.
| Property | Value | Notes |
|---|---|---|
| Appearance | Off-white to pale yellow solid | Visual description varies with purity and source |
| Solubility | Soluble in DMSO and ethanol; poorly soluble in water | Organic stock solutions are common in research |
| Typical storage | -20 °C, desiccated, protected from light | Avoid repeated freeze-thaw cycles |
| Typical analytical method | LC-MS or HPLC-UV | Reference standards are needed for quantification |
| Molar mass | Approximately 437.9 g/mol | Calculated from the reported free-base formula |
SR9009 is frequently discussed alongside other REV-ERB ligands, including synthetic agonists and natural heme-related molecules. Its selectivity for REV-ERB over related nuclear receptors has been measured in binding and reporter assays, though off-target activity at higher concentrations is possible. The compound is prohibited in sport by the World Anti-Doping Agency, and it is not approved for any medical use in major jurisdictions. Products sold online may be labeled as research chemicals, and their identity and purity are not guaranteed by regulatory review.
SR9009 is a synthetic small molecule that acts on the nuclear receptors REV-ERBα and REV-ERBβ. These receptors are part of the circadian clock machinery and normally repress transcription of certain target genes. In laboratory research, SR9009 is used as a chemical tool to study how REV-ERB activity influences metabolism, inflammation, and daily biological rhythms. The compound is not an approved medicine, and its effects in humans remain largely uncharacterized. It is often described as an investigational agent rather than a therapeutic product.
=== Spence presidency === On August 1, 2015, Wayne Spence was sworn in as PEF's ninth president and first African American president, following a close election against predecessor Susan Kent that was decided by 127 votes. A key priority for President Spence was to finalize ongoing contract talks with the Governor Andrew Cuomo Administration. During the Kent administration, the union's relations with Governor Cuomo soured, culminating in the union's endorsement of Zephyr Teachout during the 2014 New York Gubernatorial Election. Spence's election win was seen as a reset in relations with the Governor's office. Highlights during the first Spence term include the ratification of a one-year contract and a three-year contract in 2016 , and preparations for a Supreme Court ruling that threatened to end mandatory union dues. President Spence was re-elected for a second term in 2018 in a three-way race in which he received over 64% of the vote. The start of the term was highlighted by the union's response to the Janus v. AFSCME Supreme Court decision that year, which declared mandatory union dues unconstitutional. During this term, President Spence coordinated PEF's initial response to the COVID-19 pandemic, including calling on the state to permit telecommuting among state employees, urging the state government to better protect its employees from the virus, and suing the state in response to reports about state employees being paid less than their hired rate for pandemic related overtime work.
Hans von Euler-Chelpin, who received the Chemistry Prize in 1929, was the father of Ulf von Euler, who was awarded the Physiology or Medicine Prize in 1970. C. V. Raman was awarded the Physics Prize in 1930 and was the uncle of Subrahmanyan Chandrasekhar, who was awarded the same prize in 1983. Arthur Kornberg received the Physiology or Medicine Prize in 1959; Kornberg's son Roger later received the Chemistry Prize in 2006. Arthur Schawlow received the 1981 Physics prize, and was married to the sister of 1964 Physics laureate Charles Townes. Two members of the Hodgkin family received Nobels in consecutive years: Sir Alan Lloyd Hodgkin shared in the Nobel for Physiology or Medicine in 1963, followed by Dorothy Crowfoot Hodgkin, the wife of his first cousin, who won solo for Chemistry in 1964. Jan Tinbergen, who was awarded the first Economics Prize in 1969, was the brother of Nikolaas Tinbergen, who received the 1973 Physiology or Medicine Prize. Gunnar Myrdal, who was awarded the Economics Prize in 1974, was the husband of Alva Myrdal, Peace Prize laureate in 1982. Economics laureates Paul Samuelson (1970) and Kenneth Arrow (1972; shared) were brothers-in-law. Frits Zernike, who was awarded the 1953 Physics Prize, was the great-uncle of 1999 Physics laureate Gerard 't Hooft. In 2019, married couple Abhijit Banerjee and Esther Duflo were awarded the Economics Prize. Christiane Nüsslein-Volhard was awarded the Prize in Physiology or Medicine in 1995, and her nephew Benjamin List received the Chemistry Prize in 2021.
The European Aviation Safety Agency (EASA) is tasked by Article 15(4) of Regulation (EC) No 216/2008 of the European Parliament and of the Council of February 20, 2008, to provide an annual review of aviation safety. The Annual Safety Review presents statistics on European and worldwide civil aviation safety. Statistics are grouped according to type of operation, for instance, commercial air transport, and aircraft category, such as aeroplanes, helicopters, gliders, etc. The Agency has access to accident and statistical information collected by the International Civil Aviation Organization (ICAO). States are required, according to ICAO Annex 13, on Aircraft Accident and Incident Investigation, to report to ICAO information, on accidents and serious incidents to aircraft with a maximum certificated take-off mass (MTOM) over 2250 kg. Therefore, most statistics in this review concern aircraft above this mass. In addition to the ICAO data, a request was made to the EASA Member States to obtain light aircraft accident data. Furthermore, data on the operation of aircraft for commercial air transport were obtained from both ICAO and the NLR Air Transport Safety Institute.
Yeast artificial chromosome or YAC is a DNA molecule that is developed by humans to take the DNA sequences that belong to yeast cells and clone them. Yeast artificial chromosomes can be inserted with fragments of DNA from the organism of interest. Yeast cells will then assimilate the yeast artificial chromosome that contains the DNA from the organism of interest. The yeast cells then multiply in number and this brings about the amplification of the DNA that has been incorporated into it which is then isolated for the purpose of things like sequencing and mapping of the DNA desired i.e. the DNA originally inserted into the yeast artificial chromosome. Vectorette PCR helps with this process by bringing about not only the isolation of the yeast artificial chromosome’s ends but also the amplification of the ends.
The physiochemical properties of Benzodiazepines, especially lipophillicity, has a stong influence on the adsorption, metabolism and diffusion. Lipophillic benzodiazepines quickly redistribute to adipose tissue, lowering the concentration in the brain. The main biotransformations of benzodiazepines involve hepatic oxidation, N-dealkylation, hydroxylation and glucuronide conjugation.CYP3A4, CYP3A5 and CYP2C19 are primary enzymes in benzodiazepine metabolism. Glucuronidation is mediated by glucuronyltransferase (UGT). A benzodiazepine can be placed into one of three groups by its elimination half-life, or the time it takes for the body to eliminate half of the dose. Some benzodiazepines have long-acting active metabolites, such as diazepam and chlordiazepoxide, which are metabolised into desmethyldiazepam. Desmethyldiazepam has a half-life of 36–200 hours, and flurazepam, with the main active metabolite of desalkylflurazepam, with a half-life of 40–250 hours. These long-acting metabolites are partial agonists.
Sources: en.wikipedia.org
kill (90% of organisms killed in every step), tedizolid fAUC24/MIC in neutropenic mouse models with a thigh infection with VRE and MRSA should be 14.2 and 138.5, respectively. The post-antibiotic effects of tedizolid against VRE and MRSA are 2.39 and 0.99 h, respectively.
Chile's self-perception is characterized by attributions of: civilization, economic development, political order, successful national project and ethnic homogeneity with a predominance of white-western. On the contrary, the perception of Peru-Bolivia includes the attributions of barbarism, economic underdevelopment, political chaos, failed national projects, predominance of the indigenous and ethnic heterogeneity. This would imply in Chile an ethnocentric and unfavorable attitude towards the outgroup made up of Peru and Bolivia. Examples of this would be the historical narratives of the Chilean politician and orator, Benjamín Vicuña Mackenna, who spread the civilizing discourse that tried to justify the violence committed in the War of the Pacific and contaminated with anti-Peruvian sentiment. It is also known that there has been a tendency among Chilean essayists and historians to condemn the pro-Peruvian Americanists in the Spanish-South American War, accused of having been naive politicians who they were detrimental to national interests, when a pragmatic attitude should have been taken and not meddle in the Peruvian conflict of the Chincha islands due to an unrequited idealism by all the American nations (which would even isolate Chile, like the countries of the Triple Alliance). An example of this anti-Peruvian current with this historical episode is the work of Francisco Antonio Encina in his book Historia de Chile (1938–52), which has been seriously criticized by historians in the academic environment for a lack of scientific rigor.
Human feces (American English) or faeces (British English), commonly and in medical literature more often called stool, commonly referred to as poo or poop, are the solid or semisolid remains of food that could not be digested or absorbed in the small intestine of humans, but has been further broken down by bacteria in the large intestine. It also contains bacteria and a relatively small amount of metabolic waste products such as bacterially altered bilirubin, and the dead epithelial cells from the lining of the gut. It is discharged through the anus during a process called defecation. Human feces have similarities to the feces of other animals and varies significantly in appearance (i.e. size, color, texture), according to the state of the diet, digestive system, and general health. Normally, human feces are semisolid, with a mucus coating. Small pieces of harder, less moist feces can sometimes be seen impacted in the distal (final or lower) end. This is a normal occurrence when a prior bowel movement is incomplete, and feces are returned from the rectum to the large intestine, where water is further absorbed. Human feces together with human urine are collectively called human waste or excretion. Containing human feces and preventing spread of pathogens from human feces by the fecal–oral route are the main goals of sanitation.
Studies have been done to create a spectrum of deuterium water and its isotopes to measure total body water, which can be used to determine the water body overload of a patient. That measurement will then be used to determine the stage of renal failure for a patient.
They also played "Rooster" with Comes with the Fall vocalist William DuVall and Ann Wilson. The band followed the concert with a short United States club tour named "Finish What We Started", several festival dates in Europe, and a brief tour in Japan. Duff McKagan again joined the band for the reunion tour, playing rhythm guitar on selected songs. During the tour, the band played a 5-minute video tribute to Staley during the changeover from the electric to acoustic set. To coincide with the band's reunion, Sony Music released the long-delayed third Alice in Chains compilation, The Essential Alice in Chains, a double album that includes 28 songs. Jerry Cantrell met William DuVall in Los Angeles in 2000 through a mutual acquaintance who introduced Cantrell to Comes with the Fall's first album. Cantrell started hanging out with the band and occasionally joined them onstage. Between 2001 and 2002, Comes with the Fall was both the opening act on Cantrell's tour for his second solo album, Degradation Trip, and also his backing band, with DuVall singing Staley's parts at the concerts. DuVall joined Alice in Chains as lead singer during the band's reunion concerts in 2006, and made his first public performance with the band at VH1's Decades Rock Live! concert. According to Cantrell, it only took one audition for DuVall to get the gig. For his first rehearsal with the band, DuVall sang "Love, Hate, Love".
Sources: en.wikipedia.org
== Genome == The genomes of Fructilactobacillus sanfranciscensis strains are often quite small—in fact, they are suggested to be the smallest of all the lactobacilli. It is even thought that many genes within F. sanfranciscensis (that are also present in other heterofermentative lactobacilli) were lost or deleted via mutation. However, despite this loss of genes and overall smaller genome size, the F. sanfranciscensis genomes are relatively dense in ribosomal RNA (rRNA) operons, which contributes to more rapid growth and protein production. Additionally, the smaller genome allows for a significant amount of metabolic energy to be conserved. Overall, the genome length can vary from strain to strain; some can have more plasmids than others, some have slightly longer circular chromosomes, etc., but most strains share this characteristically small genome with a high density of rRNA operons, which allow for relatively fast growth rates.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
== See also == Category:Cutaneous conditions Dermatology List of conditions associated with café au lait macules List of contact allergens List of cutaneous conditions associated with increased risk of nonmelanoma skin cancer List of cutaneous conditions associated with internal malignancy List of cutaneous conditions caused by mutations in keratins List of cutaneous neoplasms associated with systemic syndromes List of cutaneous conditions caused by problems with junctional proteins List of dental abnormalities associated with cutaneous conditions List of genes mutated in cutaneous conditions List of genes mutated in pigmented cutaneous lesions List of histologic stains that aid in diagnosis of cutaneous conditions List of human leukocyte antigen alleles associated with cutaneous conditions List of immunofluorescence findings for autoimmune bullous conditions List of inclusion bodies that aid in diagnosis of cutaneous conditions List of keratins expressed in the human integumentary system List of migrating cutaneous conditions List of mites associated with cutaneous reactions List of radiographic findings associated with cutaneous conditions List of specialized glands within the human integumentary system List of spiders associated with cutaneous reactions List of target antigens in pemphigoid List of target antigens in pemphigus List of verrucous carcinoma subtypes List of xanthoma variants associated with hyperlipoproteinemia subtypes
American chemist and psychopharmacologist Alexander Shulgin reported he synthesized MDMA in 1965 while researching methylenedioxy compounds at Dow Chemical Company, but did not test the psychoactivity of the compound at this time. Around 1970, Shulgin sent instructions for N-methylated MDA (MDMA) synthesis to the founder of a Los Angeles chemical company who had requested them. This individual later provided these instructions to a client in the Midwest. Shulgin may have suspected he played a role in the emergence of MDMA in Chicago. Shulgin first heard of the psychoactive effects of N-methylated MDA around 1975 from a young student who reported "amphetamine-like content". Around 30 May 1976, Shulgin again heard about the effects of N-methylated MDA, this time from a graduate student in a medicinal chemistry group he advised at San Francisco State University who directed him to the University of Michigan study. She and two close friends had consumed 100 mg of MDMA and reported positive emotional experiences. Following the self-trials of a colleague at the University of San Francisco, Shulgin synthesized MDMA and tried it himself in September and October 1976. Shulgin and David E. Nichols first reported on MDMA and its psychoactive effects in humans in a presentation at a conference in Bethesda, Maryland in December 1976. This conference paper was subsequently formally published in 1978.
Sources: en.wikipedia.org
It is usually detected by LC-MS or HPLC-UV against a reference standard. In biological matrices, metabolite targeting can improve detection. No universal immunoassay is widely available.
The compound is generally handled as light-sensitive and stored cold and dry. Stability in solution depends on solvent, concentration, and storage time. Specific degradation rates are not fully standardized.
Limited water solubility affects formulation for cell and animal studies. Organic co-solvents are often used to dissolve it. Precipitation can confound assay results if not controlled.
SR9009 is a synthetic REV-ERB agonist used in laboratory research. It is not an approved drug, and its effects in humans are not well characterized. It is often sold as a research chemical under the name Stenabolic.